Basic Information | |
---|---|
Taxon OID | 3300020293 Open in IMG/M |
Scaffold ID | Ga0211665_1015327 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556092-ERR599063) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1584 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_100 | |||||||
Coordinates | Lat. (o) | -12.9488 | Long. (o) | -96.0293 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005751 | Metagenome / Metatranscriptome | 391 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211665_10153272 | F005751 | AGG | MSDIYTIDFEPSKLSHRQDELGLEFADLDTAVELMKKEEKMIIAELTLYFSKNGGYKNITELNGYIYSDTKFKDYFDRYERTLKQRNRAKIRFESFKAFRDDLRTKVVNERELAKHNL |
⦗Top⦘ |