Scaffold Ga0211483_10226011

Overview

Basic Information

• Taxon OID: 3300020281
• Scaffold ID: Ga0211483_10226011
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 622
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_032
• Coordinates
  • Lat. (^o): 23.4017
  • Long. (^o): 37.2183
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080483	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211483_102260112	F080483	N/A	MPYNQDFVEARAEDIFEDWVNSFFRDLTPLDESALYALALDQAIEETP