| Basic Information | |
|---|---|
| Taxon OID | 3300020281 Open in IMG/M |
| Scaffold ID | Ga0211483_10056310 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1288 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_032 | |||||||
| Coordinates | Lat. (o) | 23.4017 | Long. (o) | 37.2183 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005751 | Metagenome / Metatranscriptome | 391 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211483_100563103 | F005751 | GGAG | MTDIYSLQFDPHKISHQQEELGMIFADLDTAVELMKKEEKMIVAELTLQFSRQKMYKNMKELDGLIFNHDKFRDFTNRYSETLKKRNRAKIRFESFKAFRDDLRTKVVNERELAKVNL |
| ⦗Top⦘ |