Basic Information | |
---|---|
Taxon OID | 3300020278 Open in IMG/M |
Scaffold ID | Ga0211606_1017093 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556076-ERR599151) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1651 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_124 | |||||||
Coordinates | Lat. (o) | -9.1552 | Long. (o) | -140.5284 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025518 | Metagenome / Metatranscriptome | 201 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211606_10170933 | F025518 | N/A | MDKTVHKTKTSLKEEAKEYLPIIREFYPNLSKNLLDRISKYCVVYSKGKDKSSIRQAINDWEETFDQELTQ |
⦗Top⦘ |