Scaffold Ga0211658_1010794

Overview

Basic Information

• Taxon OID: 3300020274
• Scaffold ID: Ga0211658_1010794
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2183
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location

• Location Name: TARA_102
• Coordinates
  • Lat. (^o): -5.254
  • Long. (^o): -85.2248
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033461	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211658_10107942	F033461	AGGGGG	MGKMNAMALDHQSIIENEWEIEQRALLLSQGYTAEEVDEMIYEMINEYNYEMALDHGDWEQPNEN