NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211658_1001503

Scaffold Ga0211658_1001503


Overview

Basic Information
Taxon OID3300020274 Open in IMG/M
Scaffold IDGa0211658_1001503 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6561
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (55.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_102
CoordinatesLat. (o)-5.254Long. (o)-85.2248Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002137Metagenome / Metatranscriptome590Y
F023877Metagenome / Metatranscriptome208Y
F057664Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
Ga0211658_100150310F023877N/AMTVKQQIKEYVDDHYTHFGFYPYDVEVDGQIYSYGGYWAILEDDRFD
Ga0211658_100150312F002137AGGAMKVKELIETLSNYDGDESITFYFLKNDTLTNCQLESTCWYPDMGIEFTIQETSEAFAESGHFE
Ga0211658_10015034F057664N/AMNFSETEQLAVDTFVELQDQVKYMGLHNFEREERLLFKQGRQLLENAKKVASQKKTPYTDLEAECLLNAYLLNGADMEKARGVFFRQYPNTKHSKASVWQKISRIRTLDNLFPEDTQWETDLQIRTMCREYNYYHGEKRFAV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.