NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211484_1066434

Scaffold Ga0211484_1066434


Overview

Basic Information
Taxon OID3300020269 Open in IMG/M
Scaffold IDGa0211484_1066434 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)648
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_032
CoordinatesLat. (o)23.4017Long. (o)37.2183Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025050Metagenome203Y

Sequences

Protein IDFamilyRBSSequence
Ga0211484_10664341F025050N/AFTPKTIVRQSSSSFSIVTLSAHGFLEEDAIEVLDGQNTLLGVGRVLSVIDSSTLILGDLPGVGEFNIAFIRRRNKKGNSSLHTNINKYTTDIQNAYDNESEGNSYIASPSIPSLGNEPIVAPDRSITWTGATGGDVIQLIQVTEGAADHGFYSGEVVTYNVISGFLGQLIDGKNYYISRIDSNNIRLANSLPDLINGDFVDATGTGTFKISVPDL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.