Basic Information | |
---|---|
Taxon OID | 3300020267 Open in IMG/M |
Scaffold ID | Ga0211648_1036981 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 992 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_109 | |||||||
Coordinates | Lat. (o) | 2.0663 | Long. (o) | -84.5304 | Alt. (m) | Depth (m) | 30 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099407 | Metagenome / Metatranscriptome | 103 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211648_10369811 | F099407 | GGA | MSNDNGNKSGTLTGNATVDILQRKVTLKKELIHLRKLKIKEERQTQLLSQIEEYDNLLKQHRLKK |
⦗Top⦘ |