Scaffold Ga0211679_1083977

Overview

Basic Information

• Taxon OID: 3300020263
• Scaffold ID: Ga0211679_1083977
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX555942-ERR599125)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 529
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_085
• Coordinates
  • Lat. (^o): -61.9898
  • Long. (^o): -49.3613
  • Depth (m): 790

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064794	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211679_10839773	F064794	GGAGG	MKQKLLKLTQKITTWHVSLFEYLTRKSKTSLFFTWLLVF