NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211537_1017543

Scaffold Ga0211537_1017543


Overview

Basic Information
Taxon OID3300020262 Open in IMG/M
Scaffold IDGa0211537_1017543 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000097 (ERX556100-ERR599172)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1576
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_039
CoordinatesLat. (o)18.735Long. (o)66.3895Alt. (m)Depth (m)270
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006865Metagenome / Metatranscriptome363Y
F013774Metagenome / Metatranscriptome268Y
F037421Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0211537_10175431F013774N/AVNDKLLELKRKKLQRQILYLRTELEETEWVFQECLIDFDIEFRDYFKDPNKKTKRGVTTEPPEFDIPKEDVNVVFRMIAQKTHPDKLISKDISDTEYNAKVDMYKEAQRSVKNRDWSRVIEIAMELGIDVSNVKNDDSDYLNESVKRLTEKIKQLKSTYAWKWGNTPDQEREIMKGMILQSLGLDKIKEKENGNKK
Ga0211537_10175432F037421AGGAGMSDKPEHSDYFRELIRKLKELKISADTGEIVVPNDDEDVLAFDELELPFSPDAFDRMNSEEKEALFIWLNRDNMPQA
Ga0211537_10175433F006865GAGMGKINRIIKINDILYECLGTMSVESSEIKGTEYWKKQWGADNVLRNGNVYYYCRTIIDAEFEDI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.