Basic Information | |
---|---|
Taxon OID | 3300020261 Open in IMG/M |
Scaffold ID | Ga0211534_1085698 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556096-ERR598970) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 504 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_064 | |||||||
Coordinates | Lat. (o) | -29.5023 | Long. (o) | 37.9965 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013094 | Metagenome / Metatranscriptome | 274 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211534_10856983 | F013094 | AGGAG | MITAFFTGVIVAIPTSLVAMKLLNSSLFIDNSELRHINEKISIVINQIDEYREERFAEKE |
⦗Top⦘ |