NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211645_1050026

Scaffold Ga0211645_1050026


Overview

Basic Information
Taxon OID3300020256 Open in IMG/M
Scaffold IDGa0211645_1050026 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000929 (ERX556010-ERR599067)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)703
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_109
CoordinatesLat. (o)2.1008Long. (o)-84.5107Alt. (m)Depth (m)380
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042933Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0211645_10500261F042933N/AMKKGDKNMAVEKDINGLDFIYENKDELVFEPDPNQLEPIEDEIED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.