Scaffold Ga0211669_1000561

Overview

Basic Information

• Taxon OID: 3300020254
• Scaffold ID: Ga0211669_1000561
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001013 (ERX555924-ERR599085)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8423
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (52.94%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Parerythrobacter → Parerythrobacter jejuensis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_098
• Coordinates
  • Lat. (^o): -25.8339
  • Long. (^o): -111.8078
  • Depth (m): 488

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032812	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211669_10005616	F032812	GAGG	MWKKLWNWKIKIIRKYPVWCAYAAWLEGIIIGILIYHFWMMDVLSCCKEY