Scaffold Ga0211700_1019580

Overview

Basic Information

• Taxon OID: 3300020251
• Scaffold ID: Ga0211700_1019580
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 751
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_076
• Coordinates
  • Lat. (^o): -21.0675
  • Long. (^o): -35.3923
  • Depth (m): 150

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054095	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211700_10195802	F054095	GGAGG	MIPQWKMNGKDMRFNGDMEIGVVEVRDLFDDLVVTLWVDQEESGSIAVKTLGGIGNGRYSVQILPREKPVEEGEEWKEL