Scaffold Ga0211627_1049339

Overview

Basic Information

• Taxon OID: 3300020250
• Scaffold ID: Ga0211627_1049339
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555986-ERR599129)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 679
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED254 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_068
• Coordinates
  • Lat. (^o): -31.0263
  • Long. (^o): 4.6977
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077764	Metagenome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211627_10493393	F077764	AGGAGG	MFDLFLVNFGYVCGSYKTLDQAIKMGKKTGFQFSVYENFPNKLVWSNV