| Basic Information | |
|---|---|
| Taxon OID | 3300020247 Open in IMG/M |
| Scaffold ID | Ga0211654_1007133 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1873 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_102 | |||||||
| Coordinates | Lat. (o) | -5.2476 | Long. (o) | -85.3343 | Alt. (m) | Depth (m) | 40 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018014 | Metagenome / Metatranscriptome | 237 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211654_10071334 | F018014 | AGGTGG | MIVNLTKNEIKHLVYLLGKGDADFPELNQNILDKLQPLINACVCKSQGEN |
| ⦗Top⦘ |