Scaffold Ga0211701_1009846

Overview

Basic Information

• Taxon OID: 3300020242
• Scaffold ID: Ga0211701_1009846
• Source Dataset Name: Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555995-ERR599010)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 762
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_076
• Coordinates
  • Lat. (^o): -21.0073
  • Long. (^o): -35.3344
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056529	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211701_10098462	F056529	N/A	MATKHGNRVYIQVLLEPFRGELFIEEAAALGVKPSALIRDLVYDYLASMTNEEAYADAEMNDKKKWQDAVDARLEGRARNRRSKIDQSDATADSI