| Basic Information | |
|---|---|
| Taxon OID | 3300020235 Open in IMG/M |
| Scaffold ID | Ga0212228_1007185 Open in IMG/M |
| Source Dataset Name | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N075 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | JGI facility at Oak Ridge National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7656 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (77.78%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kermadec Trench, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -32.85037333 | Long. (o) | -177.65414 | Alt. (m) | Depth (m) | 9177 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071270 | Metagenome / Metatranscriptome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0212228_10071856 | F071270 | AGGAG | MADAYSLAKQHLDAGLKDARKNNIDENAYGQALIWKILEMYQANGRSEKDIIDEVQYTLENLDDDGTFHVSRN |
| ⦗Top⦘ |