Basic Information | |
---|---|
Taxon OID | 3300020234 Open in IMG/M |
Scaffold ID | Ga0212227_1432996 Open in IMG/M |
Source Dataset Name | Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N074 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | JGI facility at Oak Ridge National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1824 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kermadec Trench, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -34.34030667 | Long. (o) | -178.1757117 | Alt. (m) | Depth (m) | 8081 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F102416 | Metagenome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0212227_14329963 | F102416 | GAG | MGEVATTGEISMGENDWGMISKNPPMYESGVNNAVIEVTDTKNKLHKITFKKGGVLNLGREGDTLYLAWDDADTV |
⦗Top⦘ |