Scaffold Ga0212227_1221395

Overview

Basic Information

• Taxon OID: 3300020234
• Scaffold ID: Ga0212227_1221395
• Source Dataset Name: Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N074
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: JGI facility at Oak Ridge National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1253
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches

Source Dataset Sampling Location

• Location Name: Kermadec Trench, Pacific Ocean
• Coordinates
  • Lat. (^o): -34.34030667
  • Long. (^o): -178.1757117
  • Depth (m): 8081

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105206	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212227_12213952	F105206	N/A	MEESLFAGSNFITAVELLTAIAVILGIAFGLIELRQAIRNRRDLAAVDIVRTVQTQEVRQAVRQIFDLPLDADPKLIRDDPVLLAAALAVDSACEMWGCMVYEGVVSHRLLDRMVGGWVRGTWTRLRSWVESERVATQNVNVGEWWQWLYELLEEDPDPGKKLGAHIAFKGRKSR