Scaffold Ga0212226_129082

Overview

Basic Information

• Taxon OID: 3300020232
• Scaffold ID: Ga0212226_129082
• Source Dataset Name: Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR05
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: JGI facility at Oak Ridge National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2530
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches

Source Dataset Sampling Location

• Location Name: Mariana Trench, Pacific Ocean
• Coordinates
  • Lat. (^o): 11.54708
  • Long. (^o): 144.55847
  • Depth (m): 7942

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078729	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212226_1290822	F078729	AGGA	MNETRQLLKIFGVAVTDFEAEAQKLEANAAQLTADGSKEEFAKLLKESSELCAELNTRWLEVTQRIFQRQNRLQHSCADAATRLGSTNLATEIESARMEAGE