NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212168_1353231

Scaffold Ga0212168_1353231


Overview

Basic Information
Taxon OID3300020231 Open in IMG/M
Scaffold IDGa0212168_1353231 Open in IMG/M
Source Dataset NameDeep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR04
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJGI facility at Oak Ridge National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2206
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches

Source Dataset Sampling Location
Location NameMariana Trench, Pacific Ocean
CoordinatesLat. (o)12.47649Long. (o)144.86485Alt. (m)Depth (m)7939
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099318Metagenome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0212168_13532312F099318GAGMIIQIDDKIRIKGTSHCWELQSHRPYKGGMKWEPFKYFPSFRQAVADAVHREIRIHPAHGLSEAIEAVSGIVQKYEKLIPSEYKFVKKLNELDD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.