NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212168_1334521

Scaffold Ga0212168_1334521


Overview

Basic Information
Taxon OID3300020231 Open in IMG/M
Scaffold IDGa0212168_1334521 Open in IMG/M
Source Dataset NameDeep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR04
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJGI facility at Oak Ridge National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1013
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches

Source Dataset Sampling Location
Location NameMariana Trench, Pacific Ocean
CoordinatesLat. (o)12.47649Long. (o)144.86485Alt. (m)Depth (m)7939
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005148Metagenome / Metatranscriptome410Y
F009404Metagenome / Metatranscriptome318Y
F060967Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0212168_13345211F060967GGAGMNKSRVARDLWRKVFNDNLINLSDGDARKQIVREFLNDPVNKKAGWHQKDARFFRLAFQKVAKENNFNVMSINTTPT
Ga0212168_13345212F009404AGGMSSDEPKTIQPKGETLVKHCSICGVEFDETVLTNRWLKCDSCETVFQVKVKTGE
Ga0212168_13345213F005148GGAGMKQKKYQEFLKRNLPESEEVECKNCGQKFYDEWNLLSLSLLNMCLLCSNRNLDKQTIERAYNVE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.