| Basic Information | |
|---|---|
| Taxon OID | 3300020231 Open in IMG/M |
| Scaffold ID | Ga0212168_1060841 Open in IMG/M |
| Source Dataset Name | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR04 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | JGI facility at Oak Ridge National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1588 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mariana Trench, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 12.47649 | Long. (o) | 144.86485 | Alt. (m) | Depth (m) | 7939 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F102416 | Metagenome | 101 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0212168_10608413 | F102416 | GAG | MGEIATKGEISMGENDWGMISKNPPMYESGVKNAVIEVTDTENKLHKITFKKGGVLNLGREGDTLYLAWDDADTV |
| ⦗Top⦘ |