Scaffold Ga0212167_1153005

Overview

Basic Information

• Taxon OID: 3300020230
• Scaffold ID: Ga0212167_1153005
• Source Dataset Name: Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR02
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: JGI facility at Oak Ridge National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1076
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches

Source Dataset Sampling Location

• Location Name: Mariana Trench, Pacific Ocean
• Coordinates
  • Lat. (^o): 12.63117
  • Long. (^o): 144.72149
  • Depth (m): 6844

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050475	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212167_11530051	F050475	GAGG	MDNWLFGVAFFLAGIAIYRKLARWWKTPKTRVRTLLRRYRALERTGLSEQDSLLQLLATSKDWKRLPHPFLAEIVSRFPTKEDAMRFVSVSEDFGYLRDHYPGLAAKTDLAAAMGEIACLFARFGIQLQEQGRYMEAEFVQKLALRLQPDQYFTNLPLAISYHETGRHAEALPLFERGLAQVNDLERKDRPAAPEFSPANCLWTVAEIRKLRNRCKKMYAAC