Scaffold Ga0194125_10198369

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194125_10198369

Scaffold Ga0194125_10198369

Overview

Basic Information
Taxon OID	3300020222 Open in IMG/M
Scaffold ID	Ga0194125_10198369 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1442
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location Name	Tanzania: Lake Tanganyika
Coordinates	Lat. (^o)	-4.9054	Long. (^o)	29.4853	Alt. (m)		Depth (m)	250
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064426	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194125_101983691	F064426	N/A	LHPERDQVPSGMLDESFMIDFFVMYTDWFADVIEHWPDSGDELSRAFDEESPLWSRVALKRETDDPHLMLLLTTATSAMELLDCIHPETREELVSHLNEIAKIRRGECESASERAEVDAVFTAIYRFVRSTSDDARIEFLMQMMDQGHDVDGQVDPDRAVRVSASLVVASISIVVATRDLETRETFIKVLRAHTEAIAADPVVPYYESDDD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.