NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163148_10531320

Scaffold Ga0163148_10531320


Overview

Basic Information
Taxon OID3300020203 Open in IMG/M
Scaffold IDGa0163148_10531320 Open in IMG/M
Source Dataset NameFreshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)531
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat → Freshwater Microbial Mat Bacterial Communities From Lake Vanda, Mcmurdo Dry Valleys, Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Lake Vanda, McMurdo Dry Valleys
CoordinatesLat. (o)-77.5281Long. (o)161.59Alt. (m)Depth (m)19
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019586Metagenome / Metatranscriptome228Y

Sequences

Protein IDFamilyRBSSequence
Ga0163148_105313201F019586N/ADEIGIKRVAFIATLLTKADDDLFLWAQSTTVGSPEVAARVAPRLRKYMDIAGAIATLSSELENNQNKIGGRMLEVIDLINGDRDLYDQLFKVLPQDRNAEDDITVSNAVIKVGKYLSHAKAVPTSIKAKLNTNLDTEECWRIEHGDGIHIFVPVTHPGVSHLETLRKEGTELTLTN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.