Basic Information | |
---|---|
Taxon OID | 3300020200 Open in IMG/M |
Scaffold ID | Ga0194121_10154603 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1320 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Tanzania: Lake Tanganyika | |||||||
Coordinates | Lat. (o) | -6.1786 | Long. (o) | 29.658 | Alt. (m) | Depth (m) | 50 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066743 | Metagenome / Metatranscriptome | 126 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0194121_101546033 | F066743 | AGG | MIKNLKPLQSLSTEIMTETQAQLIRSIEQQLENLMLLNDDLAYQYECELYYDCNEDEEPQPIVENFTPELLTELEKVVYDYD |
⦗Top⦘ |