Scaffold Ga0194128_10229616

Overview

Basic Information

• Taxon OID: 3300020197
• Scaffold ID: Ga0194128_10229616
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 972
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -4.9054
  • Long. (^o): 29.4853
  • Depth (m): 65

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064426	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194128_102296161	F064426	GAGG	MPLFNSDDYANLHPERDQVPSGMLDESFMIDFFVMYTDWFGDIIERWPDSAEELSIAFDESSPLWSRVAPKRETDDPQLMLLLTTATSAMELLDCIHPETRDAVISHLNEIAKNRRGECEPASEKAEVDVVFSEIYRFARSTSDDARIEFLMQMMDQGHDVHGQVDPDKAVRVSASLVVASISIVVAIPDLETRDTFIKVLRAHTEAIAADPVVPYYEIDDD