Scaffold Ga0194124_10290796

Overview

Basic Information

• Taxon OID: 3300020196
• Scaffold ID: Ga0194124_10290796
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 794
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -4.9054
  • Long. (^o): 29.4853
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003329	Metagenome / Metatranscriptome	493	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194124_102907963	F003329	GGA	MAYSGTTGTTVISVQTLIDHGARRCGKLAEELTSEQVLSARESLFYVLSNLINIGIQYWAIGKKVYGLKADQYVYNLPLGGNDVLNVMYRTMNRPTPNTTGS