NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194131_10082642

Scaffold Ga0194131_10082642


Overview

Basic Information
Taxon OID3300020193 Open in IMG/M
Scaffold IDGa0194131_10082642 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1844
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-4.8915Long. (o)29.586Alt. (m)Depth (m)120
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013631Metagenome / Metatranscriptome269Y
F081258Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0194131_100826422F013631AGGAGMILDVFHYTTSRWDWHDGNVNQMWIQEIEESPDCYRYVAVAYNPRKDVSMVMSEPRCYADTLNWVRKFCGSFSILPEFSVAV
Ga0194131_100826424F081258N/AMTINFTRLSAGIYEVQKDSNTVGFIRKATASKWIVTDVVDTPQHVSKTLKEAKDACINLIIFDVDNTPADVYNESVDVDKVNPELNKKLEGSLHCYKQVPGTDKFEEVCPSEFGFAKPTLEPIEF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.