| Basic Information | |
|---|---|
| Taxon OID | 3300020192 Open in IMG/M |
| Scaffold ID | Ga0163147_10457728 Open in IMG/M |
| Source Dataset Name | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 616 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat → Freshwater Microbial Mat Bacterial Communities From Lake Vanda, Mcmurdo Dry Valleys, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Lake Vanda, McMurdo Dry Valleys | |||||||
| Coordinates | Lat. (o) | -77.5281 | Long. (o) | 161.59 | Alt. (m) | Depth (m) | 19 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007629 | Metagenome / Metatranscriptome | 347 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0163147_104577281 | F007629 | N/A | VWNTMKPLLFWNWKLMAPNAEEVKEGSNIEQKDVAKLVSKLDAKYNVKVTAQGKGQKSNHSLIEGSDNGMISSVIQSTNQSHVPRSRPRADVRPKGKDTRSNPEHKLEWKR |
| ⦗Top⦘ |