| Basic Information | |
|---|---|
| Taxon OID | 3300020187 Open in IMG/M |
| Scaffold ID | Ga0206130_10010958 Open in IMG/M |
| Source Dataset Name | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 9218 |
| Total Scaffold Genes | 19 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 18 (94.74%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Pelagic Marine Microbial Communities From North Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean: North Sea, Helgoland | |||||||
| Coordinates | Lat. (o) | 54.1841 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037491 | Metagenome | 168 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0206130_1001095817 | F037491 | AGGAG | MHFTEKRVAEYFVDLVLSDQDKSISVYGEGEEADVEQSRDRFIVLDNMGQCDFDDVGVFSEKLNGHISWFQFVYGNVTSTSEAIEVISEYSMGEYADKIYNQVEEMTS |
| ⦗Top⦘ |