Scaffold Ga0194115_10256176

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194115_10256176

Scaffold Ga0194115_10256176

Overview

Basic Information
Taxon OID	3300020183 Open in IMG/M
Scaffold ID	Ga0194115_10256176 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	824
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location Name	Tanzania: Lake Tanganyika
Coordinates	Lat. (^o)	-6.4446	Long. (^o)	29.9042	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098777	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194115_102561762	F098777	AGAAG	MTTIITITAEKIGTIDNNFYDYSGEDRILKNIISGDYEVFYSGQNQGRLDYQLEDNVNASSTFRVYYRRKSNSPFIFLGSTNYSSIVKERTIAKGINSLPNERLQIRLVIPLANISETRIDTKFEGVGKYKKAILQHSGFDIDVNINLGFYTKM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.