Scaffold Ga0194115_10133031

Overview

Basic Information

• Taxon OID: 3300020183
• Scaffold ID: Ga0194115_10133031
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1324
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -6.4446
  • Long. (^o): 29.9042
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058808	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194115_101330315	F058808	AGG	MNKIDKVKELIVETVSSYNEDWDLDLDLTEFNETVNKIDDLDKLDDYVTDFLFSEGILEKEYEVADFWKYVYREVAGLN