Scaffold Ga0194134_10081925

Overview

Basic Information

• Taxon OID: 3300020179
• Scaffold ID: Ga0194134_10081925
• Source Dataset Name: Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1642
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location

• Location Name: Tanzania: Lake Tanganyika
• Coordinates
  • Lat. (^o): -4.8915
  • Long. (^o): 29.586
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004092	Metagenome / Metatranscriptome	453	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194134_100819251	F004092	AGGA	MAEQNFSTYEGKWPCKVCQEIVKILRYWRETGDATWMCSQKHISKVNLIPPKKRKKDFVD