NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181599_1035686

Scaffold Ga0181599_1035686


Overview

Basic Information
Taxon OID3300020178 Open in IMG/M
Scaffold IDGa0181599_1035686 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2636
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Algavirales → Phycodnaviridae → Prasinovirus → unclassified Prasinovirus → Micromonas pusilla virus 12T(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014254Metagenome / Metatranscriptome264N
F020163Metagenome / Metatranscriptome225N
F079813Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0181599_10356861F079813AGTAGMDGFNTIASIAFGMLAAWAILEQRESYVPLQTDPGDDPSKYYASPMEVLGETLYVTNPESLYAGFSLEPGQQVQKIPIGPVVDRLGNAQEIP
Ga0181599_10356864F020163N/AMITILLIIGFVTLFILGRRSAYSKPASPDLWKPIEDLMPTLSRFRDLDQETYSRFEKELSRSKEEMLKPDLTILKGANLERSGMHLRRAADEFSSLAGALPSGDSVYHDEIAELAAELAVTGERVLMEAAEQTKQSYTPRLINALID
Ga0181599_10356865F014254N/AMSFKKECEQMGWWFRSKPEGVPITHTLMDGSGVLVVPLQQRARFYEICMQCLSKREKLFMVEQTKSSDRFRMFLDVDYLTTEDQGAVTDETIKRWAMHLYEAFPSLGPVLVSTCTRKQDRNYKNGIHLSWPQVTVTYGSAMNIYKRVMMEMKNFDDSVQWDSVLDKSVFKTGLRTIWAWKIKRDSKEMVVPYVPRFEVNKDGLTEIPQSKPTASMLERFSILPHGNEPNHFAGDDTIISGASVDDEFVTWIKQVYPKHNISKVEKVIPKKTHWVITTTCKYCEFIGKEHQSNHIWFLVDKESQTIMSKCHDEDHKGLSGRKLMVHPKIIKYLQKLNKV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.