NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181556_1037840

Scaffold Ga0181556_1037840


Overview

Basic Information
Taxon OID3300020176 Open in IMG/M
Scaffold IDGa0181556_1037840 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2646
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005590Metagenome / Metatranscriptome395N
F005843Metagenome / Metatranscriptome388Y
F009460Metagenome / Metatranscriptome317N

Sequences

Protein IDFamilyRBSSequence
Ga0181556_10378401F005590GGAGMTEHMTPLERWKELAIIENARMKRRLIGRDDMHAYAHKPWPLEKLRKEIRRCLSRHGELSVGDLCSMIEQDAVHIDIGLKTMRERRTIVKTSFIEGQQL
Ga0181556_10378402F009460GGAGMAKWDLSKLENSASVGAYIDEDDSTPTRPTPLMLVMSIRRKADIMRMDAGRGPERLTIKQRAEEIMALCEMLEKRL
Ga0181556_10378405F005843GGAGMTLAEPVFMAFVIFSSADECKEFAKYYDLARIFEPQCVEMGGEADYRRPWPDVRPQPRPTQGSS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.