NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211729_10809592

Scaffold Ga0211729_10809592


Overview

Basic Information
Taxon OID3300020172 Open in IMG/M
Scaffold IDGa0211729_10809592 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8261
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (14.29%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012010Metagenome / Metatranscriptome284Y
F060624Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0211729_108095922F060624AGAAGGMFLPITLKDKDGSYIEHLNVTHITRTAFINAMNPDAGTKIYLRTGEVLSTMVPMDILQQEIDECWKSASAMIIFNIIAEKTRVLSANEEPDIIDDYIEKSSSTQ
Ga0211729_108095927F012010N/AMTEIFNKFVQEDITPDGYYVLHCIKEKIVPNNFVNNSLQVTKLKRYDWLNEDLTLTNKSLIFMAEINSFFKKTKAKTLQDLLGTKFIDRIQEYIELFPNRKLSSGKYARTTSKNLETSFKWFFENYSYDWETIIKATEKYVDDYSIRNYEFMRTSQYFIRKQNIDKSFESDLATYCELLNNGFDEPDVYFKERIV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.