| Basic Information | |
|---|---|
| Taxon OID | 3300020171 Open in IMG/M |
| Scaffold ID | Ga0180732_1029637 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_0.1 MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1920 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Olkiluoto Island | |||||||
| Coordinates | Lat. (o) | 61.2413 | Long. (o) | 21.4947 | Alt. (m) | Depth (m) | 420 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088228 | Metagenome | 109 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0180732_10296372 | F088228 | AGG | MTDGSFNELELLSQEDLIVETLRKLLKTYAELSRREEVTKDFLKSLCSFSIEAYVWCILWEGGRAQRFTDILRVVGGSRGKLSDVLRELLRVGLVRMVGVRYQAVSPAWLVRSSEPNRRK |
| ⦗Top⦘ |