Scaffold Ga0206127_1048908

Overview

Basic Information

• Taxon OID: 3300020169
• Scaffold ID: Ga0206127_1048908
• Source Dataset Name: Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2167
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Schleiferiaceae → Owenweeksia → unclassified Owenweeksia → Owenweeksia sp. TMED14 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: North Sea, Helgoland
• Coordinates
  • Lat. (^o): 54.1841
  • Long. (^o): 7.9
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067735	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0206127_10489081	F067735	N/A	MIITESNLNDYIVQSKTAKTSRMLIFITPEEKEALKSLSCTSGLSMTEIL