Scaffold Ga0194039_1000092

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194039_1000092

Scaffold Ga0194039_1000092

Overview

Basic Information
Taxon OID	3300020163 Open in IMG/M
Scaffold ID	Ga0194039_1000092 Open in IMG/M
Source Dataset Name	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	58468
Total Scaffold Genes	92 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	75 (81.52%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location Name	Canada: Ontario
Coordinates	Lat. (^o)	49.688	Long. (^o)	-93.689	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103319	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194039_100009212	F103319	GGAGG	MADNYNSIGHHPKSTYMVSDGYALHNISGLDLVIDIAGLYFPLRSINYAANHNVSDEHGTGTHDPVALTNQEHTYTGSFAYASFLVTGENVMTQKDALILTQLLQDQADEGLSKYFDIYILEVQGKRTPQAGMTFEEAIEAEIGAGNFGYLEALVDCKVTKINRDIPEKNTVVSSRDFKFSYKLPR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.