Scaffold Ga0211726_10388615

Overview

Basic Information

• Taxon OID: 3300020161
• Scaffold ID: Ga0211726_10388615
• Source Dataset Name: Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: SciLifeLab
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1504
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location

• Location Name: Lake Erken, Sweden
• Coordinates
  • Lat. (^o): 59.83763399
  • Long. (^o): 18.6203826
  • Depth (m): 14 to 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050978	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211726_103886153	F050978	N/A	MHYCFDYAMDTVDYIRLDCDAQRALAYKHQLDLDGLIVNQDYTWRYQKPVYDNFAWADSEVSNVTFTFKNPALATFYQLKWS