Scaffold Ga0211733_10305439

Overview

Basic Information

• Taxon OID: 3300020160
• Scaffold ID: Ga0211733_10305439
• Source Dataset Name: Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: SciLifeLab
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 610
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location

• Location Name: Lake Erken, Sweden
• Coordinates
  • Lat. (^o): 59.83763399
  • Long. (^o): 18.6203826
  • Depth (m): 0 to 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005175	Metagenome / Metatranscriptome	409	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211733_103054393	F005175	AGG	MIDKELHVEDVIEMYNEKILILKKEIDRLNEEIQVLHIELMQERTKNE