Scaffold Ga0206107_1064591

Overview

Basic Information

• Taxon OID: 3300020137
• Scaffold ID: Ga0206107_1064591
• Source Dataset Name: Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 2B0
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 533
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.0758
  • Long. (^o): -89.4125

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099558	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0206107_10645911	F099558	N/A	DSLVPSITRRDRSIIGRLVSAVLSQWPERTRGSPPLDNYLRRDIGLEPIDHRSNYWDHQ