NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206107_1018486

Scaffold Ga0206107_1018486


Overview

Basic Information
Taxon OID3300020137 Open in IMG/M
Scaffold IDGa0206107_1018486 Open in IMG/M
Source Dataset NameEnriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 2B0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1124
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0758Long. (o)-89.4125Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013535Metagenome / Metatranscriptome270Y

Sequences

Protein IDFamilyRBSSequence
Ga0206107_10184861F013535GGAGLSVELMLMYVYRLMALGIAVGMAVVVWRKRDWQQQVFAAMIFVPFLLRGLGVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.