NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194112_10213460

Scaffold Ga0194112_10213460


Overview

Basic Information
Taxon OID3300020109 Open in IMG/M
Scaffold IDGa0194112_10213460 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1548
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-6.1786Long. (o)29.658Alt. (m)Depth (m)400
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034548Metagenome / Metatranscriptome174Y
F041806Metagenome / Metatranscriptome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0194112_102134602F034548N/AMEELFSGIQDAATPINSAGTPTQPYSNAAGDFNLRNKYGSRKVKSREDLDQPKDGEEPMRDGTAAEYIEGPLNTGGTETDDATQRYFGSFSIEAKRNVFDLLKNHPEFARKGNVNMGRVENNTREVMPHDQTKTVENGGYLIRHDLPQASQTSYPNGRKTN
Ga0194112_102134603F041806N/AMAAKLTDPATFLTSLVTKKGRSDLYGVYLTGVNILASATENYEYNVSLEKIERDVQNLFAQDPHDWNALLVETRRETEEVVFPISFLRNREPNTVYFLAEGHEMSAMVFIPTLVVEEFVTEVTFYQHLLCNVANFAGKTPTSIRFTIGSVSMEWDDLVERGCAREVDIGF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.