NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194111_10051167

Scaffold Ga0194111_10051167


Overview

Basic Information
Taxon OID3300020083 Open in IMG/M
Scaffold IDGa0194111_10051167 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3642
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-4.9054Long. (o)29.4853Alt. (m)Depth (m)300
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000545Metagenome / Metatranscriptome1038Y
F000645Metagenome / Metatranscriptome962Y
F002241Metagenome / Metatranscriptome579Y
F014613Metagenome / Metatranscriptome261Y

Sequences

Protein IDFamilyRBSSequence
Ga0194111_100511673F002241AGGMSKPHSIKYIRQMMDWGFDEEFIARDAGINVESLMTRLRRANERERRNGNQGTESGTSSGESDS
Ga0194111_100511674F000545N/AMRSDAHPFICSACKLVTPHIELHKYETSNIEDAPEEVWLVECQRCFVQRIIYPSDRVTSKEDDIVRCAQCGGWKMKAAKCRICRLAAGFEKISVKYWTGNATMERPYDEQAPLY
Ga0194111_100511675F000645GAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHILAESLVANCDVYIIKTELYRTEADAHPWTTGLSSESKSKQYALELAETGSLGRALNLAGYFAKVSQSPKKPIETTKPALAEFIKEQRPNDPEPIVWDVSELAKELGADVIDEMPLCPTGQCGPMVLKTGTKDGKEYRGWVCAKKNKAEQCAAKWMRIGADGHWVFQK
Ga0194111_100511677F014613GAGMLPNLSDEAIVGIIIGVPFIGLYIWGLFTSAKAKAFNEGYKRGRSSVRYTEIIK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.