NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206354_10019058

Scaffold Ga0206354_10019058


Overview

Basic Information
Taxon OID3300020081 Open in IMG/M
Scaffold IDGa0206354_10019058 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3020
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002850Metagenome / Metatranscriptome526Y
F004352Metagenome / Metatranscriptome442Y
F006575Metagenome / Metatranscriptome370Y

Sequences

Protein IDFamilyRBSSequence
Ga0206354_100190581F004352GGGGGMISRPEQDGDRQLRLLGDAWDKAAEHWRDGPARQFGTAQLTPLLQESRGYLEALRKLMDLLETAERETEG
Ga0206354_100190582F002850GGAVTGIHADIDALKGLHDALASYRHAQRDVTARGEDQLTATRASLEAKASRLRAQLELGQAEYTACQDRAAQADPDDPVDCSGYARAVQQNSEQLEQIRLWQQRIDAEAGEFSGIAGRFADLLENDLPRMEEHLVAIIASLEAARRVRAPAS
Ga0206354_100190584F006575GGAGMTIEPAATTSDLATATSESATATSPYLSLRRAVRPAILAHRLLAGDQERAGMLAVECEDLLYLTRELLQAAGRTRILAVVPGPRMPDESGGDRQAQLCEAYADAGLLWAKVVGSSLALAEALIERGEWEDVRALAGFLAGAGEESAATELRIRLGGAVWEEHREHLRTISNNMPPAAIELAINALRAILREVPEEFPDRNREVNCFLPPLASAVYAIMQKQGAEIPYHSRVEHIATGGVAKYPDIVKTSLDELAAEFDGICRRPGGPTT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.