Scaffold Ga0206352_10406378

Overview

Basic Information

• Taxon OID: 3300020078
• Scaffold ID: Ga0206352_10406378
• Source Dataset Name: Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 950
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029120	Metagenome / Metatranscriptome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0206352_104063782	F029120	N/A	LAEKASSALETFLDPPNLEAVGKAVEGRFVPVYRDHTKGDFWQTSKFAEMRKIAENGRIREWPAPPQAWIPDVTDARYTLSDMMSKICKDGMSIEDAQAAAQTDMMDSYSKVQKQS